PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.12659s0289.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family HD-ZIP
Protein Properties Length: 231aa    MW: 26710.7 Da    PI: 5.0559
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.12659s0289.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.25.8e-1871124356
                           --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           k++++t+ ql+ Le+ Fe+++ ++ +++  LA+klgL+ +qV vWFqNrRa++k
  Bostr.12659s0289.1.p  71 KKRKLTPIQLRLLEDSFEEEKRLDPDRKLWLAEKLGLQPNQVAVWFQNRRARYK 124
                           56699************************************************9 PP

2HD-ZIP_I/II115.92.4e-3771161292
           HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLree 90 
                           kkr+l+  q++lLE+sFeee++L+p+rK  la++Lglqp qvavWFqnrRAR+ktkqlE+d+++Lk++y +lk++ + L  ++++L+++
  Bostr.12659s0289.1.p  71 KKRKLTPIQLRLLEDSFEEEKRLDPDRKLWLAEKLGLQPNQVAVWFQNRRARYKTKQLEHDCDSLKASYAKLKTDWDILYLQNQTLKNK 159
                           9**************************************************************************************98 PP

           HD-ZIP_I/II  91 lk 92 
                           ++
  Bostr.12659s0289.1.p 160 VA 161
                           86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.41E-1955128IPR009057Homeodomain-like
PROSITE profilePS5007116.42266126IPR001356Homeobox domain
SMARTSM003894.0E-1869130IPR001356Homeobox domain
PfamPF000463.0E-1571124IPR001356Homeobox domain
CDDcd000861.26E-1571127No hitNo description
Gene3DG3DSA:1.10.10.607.6E-1973132IPR009057Homeodomain-like
PRINTSPR000319.3E-597106IPR000047Helix-turn-helix motif
PROSITE patternPS000270101124IPR017970Homeobox, conserved site
PRINTSPR000319.3E-5106122IPR000047Helix-turn-helix motif
PfamPF021839.2E-14126167IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 231 aa     Download sequence    Send to blast
MENSDTDSEV FFWFQNQNKS HSQKAQNQTP SCFPPSSHSA FYGSSSMSNT ETNTVDEEDV  60
CESYMMREIT KKRKLTPIQL RLLEDSFEEE KRLDPDRKLW LAEKLGLQPN QVAVWFQNRR  120
ARYKTKQLEH DCDSLKASYA KLKTDWDILY LQNQTLKNKV ALLKEKLRMQ ENLETQSTEG  180
KKLGKDGSLV KSDNSQYNEE EGLGNQYSFP ELADLGYYYD PTLTASNLTL *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1118126RRARYKTKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC0003481e-148AC000348.2 Genomic sequence for Arabidopsis thaliana BAC T7N9 from chromosome I, complete sequence.
GenBankCP0026841e-148CP002684.1 Arabidopsis thaliana chromosome 1 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001185103.11e-144homeobox-leucine zipper protein ATHB-54
SwissprotP0CJ651e-146ATB54_ARATH; Homeobox-leucine zipper protein ATHB-54
TrEMBLV4K9K41e-131V4K9K4_EUTSA; Uncharacterized protein
STRINGAT1G27045.11e-144(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM159081314
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G27045.11e-148HD-ZIP family protein